PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G048300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 250aa    MW: 26678.5 Da    PI: 6.7214
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G048300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB166.24.1e-5236131297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdr++Pianv+rim++vlP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyv+pl +yl+++r+
  Brast04G048300.1.p  36 REQDRLMPIANVIRIMRRVLPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVQPLALYLHRFRD 126
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +ege 
  Brast04G048300.1.p 127 FEGEA 131
                         **985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-4734134IPR009072Histone-fold
SuperFamilySSF471133.26E-3738147IPR009072Histone-fold
PfamPF008082.9E-2542105IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-156987No hitNo description
PROSITE patternPS0068507288IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-1588106No hitNo description
PRINTSPR006151.5E-15107125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEMQGFAAAG TAANGGAHQG AAAATTNGGG NAPAIREQDR LMPIANVIRI MRRVLPPHAK  60
ISDDAKETIQ ECVSEYISFI TGEANERCQR EQRKTITAED VLWAMSRLGF DDYVQPLALY  120
LHRFRDFEGE ARGGLGSRGG APPGSSSSSS MGPHQHHHHH DMQMHAMYGN PAAMPPPHHH  180
AFLMPPQPYH AQYGQQYEVY GGGEHGMGAA AAYYGGAYAP GNNGDGGNGG ASTPPQAVNF  240
EHQQPFGYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-3934126193NF-YB
4csr_A1e-3934126294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B1e-3934126294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880361e-131AB288036.1 Oryza sativa Japonica Group OsHAP3E mRNA for HAP3 subunit of HAP complex, complete cds.
GenBankAK1078611e-131AK107861.1 Oryza sativa Japonica Group cDNA clone:002-134-B07, full insert sequence.
GenBankAP0041791e-131AP004179.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1124_G07.
GenBankAP0149581e-131AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAY0621841e-131AY062184.1 Oryza sativa (indica cultivar-group) HAP3 transcriptional-activator (LEC1B) mRNA, complete cds.
GenBankAY0621851e-131AY062185.1 Oryza sativa (indica cultivar-group) HAP3 transcriptional-activator (LEC1B) gene, complete cds.
GenBankAY2642841e-131AY264284.1 Oryza sativa (indica cultivar-group) leafy cotyledon 1 gene, complete cds.
GenBankCP0126101e-131CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570473.11e-91PREDICTED: nuclear transcription factor Y subunit B-3-like
TrEMBLI1IEB51e-91I1IEB5_BRADI; Uncharacterized protein
STRINGBRADI3G56400.13e-91(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-60nuclear factor Y, subunit B6